PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0045800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Whirly
Protein Properties Length: 253aa    MW: 27733.6 Da    PI: 9.5818
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0045800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly2027.3e-63762141139
          Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalk 95 
                     s+yk+kaal+v++++p+f  ldsg+ kl+++G ++l++a+a+++r+ydW++kq+f+ls+ e+++l++l++k+sceffhdp++++s+eGk+rk+lk
  Spipo0G0045800  76 SIYKGKAALTVEPRAPEFAPLDSGAYKLSKEGCIFLQFAPAIGTRQYDWNRKQVFSLSVSEIGTLMNLGTKDSCEFFHDPFKGKSDEGKIRKVLK 170
                     7********************************************************************************************** PP

          Whirly  96 vePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                      eP+pdG G+f+nlsv+n l++++e++++P+++aef+vl+s+++
  Spipo0G0045800 171 AEPFPDGGGHFFNLSVQNRLQNVDENIYIPITRAEFTVLNSAFN 214
                     ****************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.104.4E-7567236IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544476.51E-7170251IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.2E-5977211IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0009507Cellular Componentchloroplast
GO:0009508Cellular Componentplastid chromosome
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MELLSSSVPL RNPKISPSVL LSPTPAGRVF LPRTVSVGKR GFSLKCSRAD FYETQQQRVS  60
GPGEGAPMAK VFVGHSIYKG KAALTVEPRA PEFAPLDSGA YKLSKEGCIF LQFAPAIGTR  120
QYDWNRKQVF SLSVSEIGTL MNLGTKDSCE FFHDPFKGKS DEGKIRKVLK AEPFPDGGGH  180
FFNLSVQNRL QNVDENIYIP ITRAEFTVLN SAFNFVIPYF LGWHAFVESM KAEDGARSNG  240
AGRSGAESEW GR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A1e-1036525032218p24: plant transcriptional regulator PBF-2
1l3a_B1e-1036525032218p24: plant transcriptional regulator PBF-2
1l3a_C1e-1036525032218p24: plant transcriptional regulator PBF-2
1l3a_D1e-1036525032218p24: plant transcriptional regulator PBF-2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008809721.11e-111PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X1
RefseqXP_010915145.11e-111PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3
RefseqXP_010915146.11e-111PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like isoform X3
SwissprotQ9LL851e-107WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLM0RK351e-107M0RK35_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P21100_0011e-107(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-100ssDNA-binding transcriptional regulator